Detailed information of TA system TA290528

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 18297..18566
• Replicon: plasmid 3
• Accession: NZ_LR890290
• Organism: Escherichia coli isolate MSB1_1A-sc-2280383

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: JMW08_RS24080
• Protein ID: WP_001312861.1
• Coordinates: 18408..18566 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	18297..18362 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMW08_RS24045	13303..13764	-	462	WP_160371810.1	hypothetical protein	-
JMW08_RS24050	14066..14593	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
JMW08_RS24055	14651..14884	+	234	WP_000006003.1	DUF905 family protein	-
JMW08_RS24060	14945..16909	+	1965	WP_000117319.1	ParB/RepB/Spo0J family partition protein	-
JMW08_RS24065	16978..17412	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
JMW08_RS24070	17409..18128	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	18140..18364	+	225	NuclAT_0	-	-
-	18140..18364	+	225	NuclAT_0	-	-
-	18140..18364	+	225	NuclAT_0	-	-
-	18140..18364	+	225	NuclAT_0	-	-
-	18140..18364	-	225	NuclAT_0	-	-
JMW08_RS24075	18149..18328	-	180	WP_001309233.1	hypothetical protein	-
-	18297..18362	+	66	NuclAT_1	-	-
JMW08_RS24080	18408..18566	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
JMW08_RS24085	18804..19181	-	378	Protein_28	hypothetical protein	-
JMW08_RS24090	19481..19777	+	297	WP_001272251.1	hypothetical protein	-
JMW08_RS24095	19888..20709	+	822	WP_001234445.1	DUF945 domain-containing protein	-
JMW08_RS24100	21006..21596	-	591	WP_148713293.1	transglycosylase SLT domain-containing protein	-
JMW08_RS24105	21939..22322	+	384	WP_001151562.1	relaxosome protein TraM	-
JMW08_RS24110	22516..23202	+	687	WP_000332499.1	PAS domain-containing protein	-
JMW08_RS24115	23296..23523	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..62174	62174

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T290528 WP_001312861.1 NZ_LR890290:18408-18566 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT290528 NZ_LR890290:c18362-18297 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin