Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 130428..130661 | Replicon | plasmid 2 |
| Accession | NZ_LR890289 | ||
| Organism | Escherichia coli isolate MSB1_1A-sc-2280383 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JMW08_RS23685 | Protein ID | WP_001312861.1 |
| Coordinates | 130428..130586 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 130630..130661 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW08_RS23660 | 125802..126491 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| JMW08_RS23665 | 126678..127061 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| JMW08_RS23670 | 127382..127984 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| JMW08_RS23675 | 128281..129102 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| JMW08_RS23680 | 129220..129507 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JMW08_RS23685 | 130428..130586 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 130630..130661 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 130630..130661 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 130630..130661 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 130630..130661 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 132103..132300 | - | 198 | NuclAT_0 | - | - |
| - | 132103..132300 | - | 198 | NuclAT_0 | - | - |
| - | 132103..132300 | - | 198 | NuclAT_0 | - | - |
| - | 132103..132300 | - | 198 | NuclAT_0 | - | - |
| JMW08_RS23695 | 132112..132300 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| JMW08_RS23700 | 132312..133031 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| JMW08_RS23705 | 133028..133462 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| JMW08_RS23710 | 133517..133714 | - | 198 | Protein_157 | hypothetical protein | - |
| JMW08_RS23715 | 133742..133975 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| JMW08_RS23720 | 134043..134582 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| JMW08_RS23725 | 134608..134814 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| JMW08_RS23730 | 135224..135424 | - | 201 | WP_025492130.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..173787 | 173787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290520 WP_001312861.1 NZ_LR890289:c130586-130428 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 32 bp
>AT290520 NZ_LR890289:c130661-130630 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
