Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 85312..85566 | Replicon | plasmid 2 |
| Accession | NZ_LR890289 | ||
| Organism | Escherichia coli isolate MSB1_1A-sc-2280383 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | JMW08_RS23430 | Protein ID | WP_015387399.1 |
| Coordinates | 85312..85518 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 85505..85566 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW08_RS23400 | 80559..81470 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| JMW08_RS23405 | 81481..82701 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| JMW08_RS23410 | 83594..84076 | + | 483 | Protein_97 | VENN motif pre-toxin domain-containing protein | - |
| JMW08_RS23415 | 84022..84468 | - | 447 | Protein_98 | incFII family plasmid replication initiator RepA | - |
| JMW08_RS23420 | 84461..84535 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| JMW08_RS23425 | 84771..85028 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| JMW08_RS23430 | 85312..85518 | - | 207 | WP_015387399.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 85505..85566 | + | 62 | NuclAT_2 | - | Antitoxin |
| - | 85505..85566 | + | 62 | NuclAT_2 | - | Antitoxin |
| - | 85505..85566 | + | 62 | NuclAT_2 | - | Antitoxin |
| - | 85505..85566 | + | 62 | NuclAT_2 | - | Antitoxin |
| JMW08_RS23435 | 85705..85887 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| JMW08_RS23440 | 85988..86604 | + | 617 | Protein_103 | IS1 family transposase | - |
| JMW08_RS23445 | 86642..88213 | - | 1572 | WP_023149734.1 | IS66 family transposase | - |
| JMW08_RS23450 | 88233..88580 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JMW08_RS23455 | 88580..89257 | - | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| JMW08_RS23460 | 89312..89401 | + | 90 | Protein_107 | IS1 family transposase | - |
| JMW08_RS23465 | 89702..89914 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..173787 | 173787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7720.23 Da Isoelectric Point: 9.3127
>T290516 WP_015387399.1 NZ_LR890289:c85518-85312 [Escherichia coli]
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
Antitoxin
Download Length: 62 bp
>AT290516 NZ_LR890289:85505-85566 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|