Detailed information of TA system TA290516

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 85312..85566
• Replicon: plasmid 2
• Accession: NZ_LR890289
• Organism: Escherichia coli isolate MSB1_1A-sc-2280383

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: JMW08_RS23430
• Protein ID: WP_015387399.1
• Coordinates: 85312..85518 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	85505..85566 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMW08_RS23400	80559..81470	-	912	WP_000440183.1	carbamate kinase	-
JMW08_RS23405	81481..82701	-	1221	WP_000410951.1	arginine deiminase	-
JMW08_RS23410	83594..84076	+	483	Protein_97	VENN motif pre-toxin domain-containing protein	-
JMW08_RS23415	84022..84468	-	447	Protein_98	incFII family plasmid replication initiator RepA	-
JMW08_RS23420	84461..84535	-	75	WP_032336874.1	RepA leader peptide Tap	-
JMW08_RS23425	84771..85028	-	258	WP_000083833.1	replication regulatory protein RepA	-
JMW08_RS23430	85312..85518	-	207	WP_015387399.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	85505..85566	+	62	NuclAT_2	-	Antitoxin
-	85505..85566	+	62	NuclAT_2	-	Antitoxin
-	85505..85566	+	62	NuclAT_2	-	Antitoxin
-	85505..85566	+	62	NuclAT_2	-	Antitoxin
JMW08_RS23435	85705..85887	-	183	WP_000968309.1	hypothetical protein	-
JMW08_RS23440	85988..86604	+	617	Protein_103	IS1 family transposase	-
JMW08_RS23445	86642..88213	-	1572	WP_023149734.1	IS66 family transposase	-
JMW08_RS23450	88233..88580	-	348	WP_000624622.1	IS66 family insertion sequence element accessory protein TnpB	-
JMW08_RS23455	88580..89257	-	678	WP_001339397.1	IS66 family insertion sequence hypothetical protein	-
JMW08_RS23460	89312..89401	+	90	Protein_107	IS1 family transposase	-
JMW08_RS23465	89702..89914	-	213	WP_005012601.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD	iutA / iucD / iucC / iucB / iucA	1..173787	173787

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7720.23 Da
• Isoelectric Point: 9.3127

>T290516 WP_015387399.1 NZ_LR890289:c85518-85312 [Escherichia coli]
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

Antitoxin

Nucleotide

• Length: 62 bp

>AT290516 NZ_LR890289:85505-85566 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin