Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
| Location | 4075552..4075964 | Replicon | chromosome |
| Accession | NZ_LR890288 | ||
| Organism | Escherichia coli isolate MSB1_1A-sc-2280383 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | JMW08_RS19400 | Protein ID | WP_000132601.1 |
| Coordinates | 4075623..4075964 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4075552..4075628 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW08_RS19385 | 4071091..4072680 | + | 1590 | WP_001063200.1 | type I restriction-modification system methyltransferase | - |
| JMW08_RS19390 | 4072677..4074071 | + | 1395 | WP_001272445.1 | type I restriction-modification system specificity subunit | - |
| JMW08_RS19395 | 4074246..4075466 | - | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| - | 4075552..4075628 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_14 | - | Antitoxin |
| - | 4075552..4075628 | - | 77 | NuclAT_14 | - | Antitoxin |
| JMW08_RS19400 | 4075623..4075964 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| JMW08_RS19405 | 4076126..4077505 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| JMW08_RS19410 | 4077505..4078551 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4074246..4090231 | 15985 | |
| - | flank | IS/Tn | - | - | 4074246..4075466 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T290509 WP_000132601.1 NZ_LR890288:4075623-4075964 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT290509 NZ_LR890288:c4075628-4075552 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|