Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1066722..1067449 | Replicon | chromosome |
| Accession | NZ_LR890288 | ||
| Organism | Escherichia coli isolate MSB1_1A-sc-2280383 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A829L2T9 |
| Locus tag | JMW08_RS05145 | Protein ID | WP_001521139.1 |
| Coordinates | 1066722..1067033 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMW08_RS05150 | Protein ID | WP_000126294.1 |
| Coordinates | 1067030..1067449 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW08_RS05120 | 1062657..1064366 | + | 1710 | WP_001521140.1 | formate hydrogenlyase subunit HycE | - |
| JMW08_RS05125 | 1064376..1064918 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| JMW08_RS05130 | 1064918..1065685 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| JMW08_RS05135 | 1065682..1066092 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| JMW08_RS05140 | 1066085..1066555 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| JMW08_RS05145 | 1066722..1067033 | + | 312 | WP_001521139.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| JMW08_RS05150 | 1067030..1067449 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMW08_RS05155 | 1067528..1068952 | - | 1425 | WP_020234028.1 | 6-phospho-beta-glucosidase AscB | - |
| JMW08_RS05160 | 1068961..1070418 | - | 1458 | WP_020234027.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| JMW08_RS05165 | 1070678..1071688 | + | 1011 | WP_015912547.1 | DNA-binding transcriptional regulator AscG | - |
| JMW08_RS05170 | 1071837..1072364 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12493.23 Da Isoelectric Point: 9.4783
>T290497 WP_001521139.1 NZ_LR890288:1066722-1067033 [Escherichia coli]
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT290497 WP_000126294.1 NZ_LR890288:1067030-1067449 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|