Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 622838..623637 | Replicon | chromosome |
Accession | NZ_LR890288 | ||
Organism | Escherichia coli isolate MSB1_1A-sc-2280383 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D3GWU5 |
Locus tag | JMW08_RS03020 | Protein ID | WP_000347272.1 |
Coordinates | 622838..623302 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | JMW08_RS03025 | Protein ID | WP_001307405.1 |
Coordinates | 623302..623637 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW08_RS02990 | 617839..618273 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
JMW08_RS02995 | 618291..619169 | - | 879 | WP_001298314.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JMW08_RS03000 | 619159..619938 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JMW08_RS03005 | 619949..620422 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JMW08_RS03010 | 620445..621725 | - | 1281 | WP_001521382.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JMW08_RS03015 | 621974..622783 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
JMW08_RS03020 | 622838..623302 | - | 465 | WP_000347272.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JMW08_RS03025 | 623302..623637 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JMW08_RS03030 | 623786..625357 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
JMW08_RS03035 | 625732..627066 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
JMW08_RS03040 | 627082..627852 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 622838..634290 | 11452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17832.26 Da Isoelectric Point: 9.6924
>T290493 WP_000347272.1 NZ_LR890288:c623302-622838 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829KUD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |