Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 46498..47172 | Replicon | plasmid 2 |
| Accession | NZ_LR890278 | ||
| Organism | Klebsiella pneumoniae isolate INF355-sc-2280185 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LMS5 |
| Locus tag | JMV94_RS25115 | Protein ID | WP_032720638.1 |
| Coordinates | 46498..46821 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMV94_RS25120 | Protein ID | WP_032720637.1 |
| Coordinates | 46870..47172 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV94_RS25090 | 41524..41847 | + | 324 | WP_019725650.1 | hypothetical protein | - |
| JMV94_RS25095 | 42318..43022 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| JMV94_RS25100 | 43182..44528 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| JMV94_RS25105 | 44839..45441 | + | 603 | Protein_49 | transposase | - |
| JMV94_RS25110 | 45768..46320 | + | 553 | Protein_50 | DUF4113 domain-containing protein | - |
| JMV94_RS25115 | 46498..46821 | + | 324 | WP_032720638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV94_RS25120 | 46870..47172 | + | 303 | WP_032720637.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMV94_RS25125 | 47215..47382 | - | 168 | WP_153591440.1 | hypothetical protein | - |
| JMV94_RS25130 | 47570..47749 | - | 180 | WP_032720701.1 | hypothetical protein | - |
| JMV94_RS25135 | 47773..48156 | - | 384 | WP_032720636.1 | hypothetical protein | - |
| JMV94_RS25140 | 48261..48833 | - | 573 | WP_032720635.1 | GNAT family N-acetyltransferase | - |
| JMV94_RS25145 | 48835..49623 | - | 789 | WP_032720700.1 | TSUP family transporter | - |
| JMV94_RS25150 | 49659..50579 | - | 921 | WP_050548604.1 | TauD/TfdA family dioxygenase | - |
| JMV94_RS25155 | 50882..51376 | - | 495 | WP_044266755.1 | hypothetical protein | - |
| JMV94_RS25160 | 51407..51979 | - | 573 | WP_044266753.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB1 / dfrA14 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B | - | 1..184852 | 184852 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12372.29 Da Isoelectric Point: 9.6240
>T290475 WP_032720638.1 NZ_LR890278:46498-46821 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|