Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3716871..3717468 | Replicon | chromosome |
Accession | NZ_LR890277 | ||
Organism | Klebsiella pneumoniae isolate INF355-sc-2280185 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9J6S5A1 |
Locus tag | JMV94_RS18230 | Protein ID | WP_004893639.1 |
Coordinates | 3717151..3717468 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | JMV94_RS18225 | Protein ID | WP_004142561.1 |
Coordinates | 3716871..3717158 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV94_RS18195 | 3712951..3713199 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
JMV94_RS18200 | 3713217..3713558 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
JMV94_RS18205 | 3713589..3714704 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
JMV94_RS18210 | 3714884..3715468 | + | 585 | WP_002893026.1 | TetR/AcrR family transcriptional regulator | - |
JMV94_RS18215 | 3715465..3715833 | + | 369 | WP_002893024.1 | MmcQ/YjbR family DNA-binding protein | - |
JMV94_RS18220 | 3715953..3716606 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
JMV94_RS18225 | 3716871..3717158 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMV94_RS18230 | 3717151..3717468 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV94_RS18235 | 3717653..3718696 | - | 1044 | WP_021314069.1 | DUF2157 domain-containing protein | - |
JMV94_RS18240 | 3719362..3720228 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
JMV94_RS18245 | 3720337..3721764 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T290469 WP_004893639.1 NZ_LR890277:c3717468-3717151 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|