Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 726939..727714 | Replicon | chromosome |
Accession | NZ_LR890277 | ||
Organism | Klebsiella pneumoniae isolate INF355-sc-2280185 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | JMV94_RS03625 | Protein ID | WP_021314147.1 |
Coordinates | 727229..727714 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMV94_RS03620 | Protein ID | WP_004150912.1 |
Coordinates | 726939..727232 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV94_RS03600 | 722147..722749 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
JMV94_RS03605 | 722847..723758 | + | 912 | WP_201524319.1 | LysR family transcriptional regulator | - |
JMV94_RS03610 | 723759..724907 | - | 1149 | WP_020316731.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMV94_RS03615 | 724918..726294 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
JMV94_RS03620 | 726939..727232 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMV94_RS03625 | 727229..727714 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
JMV94_RS03630 | 728418..729011 | + | 594 | WP_004188553.1 | hypothetical protein | - |
JMV94_RS03635 | 729108..729324 | + | 217 | Protein_712 | transposase | - |
JMV94_RS03645 | 729839..730552 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 729108..729260 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T290462 WP_021314147.1 NZ_LR890277:727229-727714 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |