Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 48451..48715 Replicon plasmid 3
Accession NZ_LR890272
Organism Escherichia coli isolate MINF_7C-sc-2280452

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag JMW01_RS24995 Protein ID WP_001303307.1
Coordinates 48563..48715 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 48451..48508 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW01_RS24980 43690..45981 - 2292 WP_001289282.1 hypothetical protein -
JMW01_RS24985 45974..47044 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
JMW01_RS24990 47063..48271 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- 48451..48508 - 58 NuclAT_0 - Antitoxin
- 48451..48508 - 58 NuclAT_0 - Antitoxin
- 48451..48508 - 58 NuclAT_0 - Antitoxin
- 48451..48508 - 58 NuclAT_0 - Antitoxin
JMW01_RS24995 48563..48715 + 153 WP_001303307.1 Hok/Gef family protein Toxin
JMW01_RS25000 48787..49038 - 252 WP_001291965.1 hypothetical protein -
JMW01_RS25005 49697..49873 - 177 WP_001054897.1 hypothetical protein -
JMW01_RS25010 50265..50474 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
JMW01_RS25015 50546..51196 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
JMW01_RS25020 51270..53438 - 2169 WP_201511036.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IId - 1..95130 95130


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T290454 WP_001303307.1 NZ_LR890272:48563-48715 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT290454 NZ_LR890272:c48508-48451 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References