Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 52274..52700 | Replicon | plasmid 2 |
| Accession | NZ_LR890271 | ||
| Organism | Escherichia coli isolate MINF_7C-sc-2280452 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JMW01_RS24290 | Protein ID | WP_001312861.1 |
| Coordinates | 52274..52432 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 52476..52700 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW01_RS24255 | 47320..47547 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| JMW01_RS24260 | 47641..48327 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| JMW01_RS24265 | 48518..48901 | - | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| JMW01_RS24270 | 49178..49825 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| JMW01_RS24275 | 50122..50943 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JMW01_RS24280 | 51065..51352 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JMW01_RS24285 | 51377..51583 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| JMW01_RS24290 | 52274..52432 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 52476..52700 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 52476..52700 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 52476..52700 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 52476..52700 | - | 225 | NuclAT_0 | - | Antitoxin |
| JMW01_RS24295 | 52512..52700 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| JMW01_RS24300 | 52712..53431 | - | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
| JMW01_RS24305 | 53428..53862 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| JMW01_RS24310 | 53917..55875 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| JMW01_RS24315 | 55934..56167 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| JMW01_RS24320 | 56223..56750 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / aac(3)-IIa / sitABCD / tet(A) | - | 1..118421 | 118421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290448 WP_001312861.1 NZ_LR890271:c52432-52274 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT290448 NZ_LR890271:c52700-52476 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|