Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4989235..4989456 Replicon chromosome
Accession NZ_LR890270
Organism Escherichia coli isolate MINF_7C-sc-2280452

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag JMW01_RS23510 Protein ID WP_000170965.1
Coordinates 4989235..4989342 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4989390..4989456 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW01_RS23485 4985080..4986162 + 1083 WP_000804726.1 peptide chain release factor 1 -
JMW01_RS23490 4986162..4986995 + 834 WP_001586940.1 peptide chain release factor N(5)-glutamine methyltransferase -
JMW01_RS23495 4986992..4987384 + 393 WP_000200387.1 invasion regulator SirB2 -
JMW01_RS23500 4987388..4988197 + 810 WP_001257044.1 invasion regulator SirB1 -
JMW01_RS23505 4988233..4989087 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JMW01_RS23510 4989235..4989342 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4989390..4989456 + 67 NuclAT_16 - Antitoxin
- 4989390..4989456 + 67 NuclAT_16 - Antitoxin
- 4989390..4989456 + 67 NuclAT_16 - Antitoxin
- 4989390..4989456 + 67 NuclAT_16 - Antitoxin
- 4989390..4989456 + 67 NuclAT_18 - Antitoxin
- 4989390..4989456 + 67 NuclAT_18 - Antitoxin
- 4989390..4989456 + 67 NuclAT_18 - Antitoxin
- 4989390..4989456 + 67 NuclAT_18 - Antitoxin
- 4989390..4989456 + 67 NuclAT_20 - Antitoxin
- 4989390..4989456 + 67 NuclAT_20 - Antitoxin
- 4989390..4989456 + 67 NuclAT_20 - Antitoxin
- 4989390..4989456 + 67 NuclAT_20 - Antitoxin
- 4989390..4989456 + 67 NuclAT_22 - Antitoxin
- 4989390..4989456 + 67 NuclAT_22 - Antitoxin
- 4989390..4989456 + 67 NuclAT_22 - Antitoxin
- 4989390..4989456 + 67 NuclAT_22 - Antitoxin
- 4989390..4989456 + 67 NuclAT_24 - Antitoxin
- 4989390..4989456 + 67 NuclAT_24 - Antitoxin
- 4989390..4989456 + 67 NuclAT_24 - Antitoxin
- 4989390..4989456 + 67 NuclAT_24 - Antitoxin
- 4989390..4989456 + 67 NuclAT_26 - Antitoxin
- 4989390..4989456 + 67 NuclAT_26 - Antitoxin
- 4989390..4989456 + 67 NuclAT_26 - Antitoxin
- 4989390..4989456 + 67 NuclAT_26 - Antitoxin
- 4989392..4989455 + 64 NuclAT_29 - -
- 4989392..4989455 + 64 NuclAT_29 - -
- 4989392..4989455 + 64 NuclAT_29 - -
- 4989392..4989455 + 64 NuclAT_29 - -
- 4989392..4989455 + 64 NuclAT_31 - -
- 4989392..4989455 + 64 NuclAT_31 - -
- 4989392..4989455 + 64 NuclAT_31 - -
- 4989392..4989455 + 64 NuclAT_31 - -
- 4989392..4989455 + 64 NuclAT_33 - -
- 4989392..4989455 + 64 NuclAT_33 - -
- 4989392..4989455 + 64 NuclAT_33 - -
- 4989392..4989455 + 64 NuclAT_33 - -
- 4989392..4989455 + 64 NuclAT_35 - -
- 4989392..4989455 + 64 NuclAT_35 - -
- 4989392..4989455 + 64 NuclAT_35 - -
- 4989392..4989455 + 64 NuclAT_35 - -
- 4989392..4989455 + 64 NuclAT_37 - -
- 4989392..4989455 + 64 NuclAT_37 - -
- 4989392..4989455 + 64 NuclAT_37 - -
- 4989392..4989455 + 64 NuclAT_37 - -
- 4989392..4989455 + 64 NuclAT_39 - -
- 4989392..4989455 + 64 NuclAT_39 - -
- 4989392..4989455 + 64 NuclAT_39 - -
- 4989392..4989455 + 64 NuclAT_39 - -
- 4989392..4989457 + 66 NuclAT_41 - -
- 4989392..4989457 + 66 NuclAT_41 - -
- 4989392..4989457 + 66 NuclAT_41 - -
- 4989392..4989457 + 66 NuclAT_41 - -
- 4989392..4989457 + 66 NuclAT_43 - -
- 4989392..4989457 + 66 NuclAT_43 - -
- 4989392..4989457 + 66 NuclAT_43 - -
- 4989392..4989457 + 66 NuclAT_43 - -
JMW01_RS23515 4989770..4989877 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4989930..4989991 + 62 NuclAT_28 - -
- 4989930..4989991 + 62 NuclAT_28 - -
- 4989930..4989991 + 62 NuclAT_28 - -
- 4989930..4989991 + 62 NuclAT_28 - -
- 4989930..4989991 + 62 NuclAT_30 - -
- 4989930..4989991 + 62 NuclAT_30 - -
- 4989930..4989991 + 62 NuclAT_30 - -
- 4989930..4989991 + 62 NuclAT_30 - -
- 4989930..4989991 + 62 NuclAT_32 - -
- 4989930..4989991 + 62 NuclAT_32 - -
- 4989930..4989991 + 62 NuclAT_32 - -
- 4989930..4989991 + 62 NuclAT_32 - -
- 4989930..4989991 + 62 NuclAT_34 - -
- 4989930..4989991 + 62 NuclAT_34 - -
- 4989930..4989991 + 62 NuclAT_34 - -
- 4989930..4989991 + 62 NuclAT_34 - -
- 4989930..4989991 + 62 NuclAT_36 - -
- 4989930..4989991 + 62 NuclAT_36 - -
- 4989930..4989991 + 62 NuclAT_36 - -
- 4989930..4989991 + 62 NuclAT_36 - -
- 4989930..4989991 + 62 NuclAT_38 - -
- 4989930..4989991 + 62 NuclAT_38 - -
- 4989930..4989991 + 62 NuclAT_38 - -
- 4989930..4989991 + 62 NuclAT_38 - -
- 4989930..4989992 + 63 NuclAT_17 - -
- 4989930..4989992 + 63 NuclAT_17 - -
- 4989930..4989992 + 63 NuclAT_17 - -
- 4989930..4989992 + 63 NuclAT_17 - -
- 4989930..4989992 + 63 NuclAT_19 - -
- 4989930..4989992 + 63 NuclAT_19 - -
- 4989930..4989992 + 63 NuclAT_19 - -
- 4989930..4989992 + 63 NuclAT_19 - -
- 4989930..4989992 + 63 NuclAT_21 - -
- 4989930..4989992 + 63 NuclAT_21 - -
- 4989930..4989992 + 63 NuclAT_21 - -
- 4989930..4989992 + 63 NuclAT_21 - -
- 4989930..4989992 + 63 NuclAT_23 - -
- 4989930..4989992 + 63 NuclAT_23 - -
- 4989930..4989992 + 63 NuclAT_23 - -
- 4989930..4989992 + 63 NuclAT_23 - -
- 4989930..4989992 + 63 NuclAT_25 - -
- 4989930..4989992 + 63 NuclAT_25 - -
- 4989930..4989992 + 63 NuclAT_25 - -
- 4989930..4989992 + 63 NuclAT_25 - -
- 4989930..4989992 + 63 NuclAT_27 - -
- 4989930..4989992 + 63 NuclAT_27 - -
- 4989930..4989992 + 63 NuclAT_27 - -
- 4989930..4989992 + 63 NuclAT_27 - -
- 4989930..4989993 + 64 NuclAT_40 - -
- 4989930..4989993 + 64 NuclAT_40 - -
- 4989930..4989993 + 64 NuclAT_40 - -
- 4989930..4989993 + 64 NuclAT_40 - -
- 4989930..4989993 + 64 NuclAT_42 - -
- 4989930..4989993 + 64 NuclAT_42 - -
- 4989930..4989993 + 64 NuclAT_42 - -
- 4989930..4989993 + 64 NuclAT_42 - -
JMW01_RS23520 4990283..4991383 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
JMW01_RS23525 4991653..4991883 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JMW01_RS23530 4992041..4992736 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
JMW01_RS23535 4992780..4993133 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T290444 WP_000170965.1 NZ_LR890270:c4989342-4989235 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT290444 NZ_LR890270:4989390-4989456 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References