Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4989235..4989456 | Replicon | chromosome |
| Accession | NZ_LR890270 | ||
| Organism | Escherichia coli isolate MINF_7C-sc-2280452 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | JMW01_RS23510 | Protein ID | WP_000170965.1 |
| Coordinates | 4989235..4989342 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4989390..4989456 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW01_RS23485 | 4985080..4986162 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| JMW01_RS23490 | 4986162..4986995 | + | 834 | WP_001586940.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JMW01_RS23495 | 4986992..4987384 | + | 393 | WP_000200387.1 | invasion regulator SirB2 | - |
| JMW01_RS23500 | 4987388..4988197 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| JMW01_RS23505 | 4988233..4989087 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JMW01_RS23510 | 4989235..4989342 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4989390..4989456 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 4989390..4989456 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 4989392..4989455 | + | 64 | NuclAT_29 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_29 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_29 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_29 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_31 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_31 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_31 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_31 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_33 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_33 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_33 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_33 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_35 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_35 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_35 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_35 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_37 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_37 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_37 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_37 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_39 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_39 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_39 | - | - |
| - | 4989392..4989455 | + | 64 | NuclAT_39 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_41 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_41 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_41 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_41 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_43 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_43 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_43 | - | - |
| - | 4989392..4989457 | + | 66 | NuclAT_43 | - | - |
| JMW01_RS23515 | 4989770..4989877 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 4989930..4989991 | + | 62 | NuclAT_28 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_28 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_28 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_28 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_30 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_30 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_30 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_30 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_32 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_32 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_32 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_32 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_34 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_34 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_34 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_34 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_36 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_36 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_36 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_36 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_38 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_38 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_38 | - | - |
| - | 4989930..4989991 | + | 62 | NuclAT_38 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_17 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_17 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_17 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_17 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_19 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_19 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_19 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_19 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_21 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_21 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_21 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_21 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_23 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_23 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_23 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_23 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_25 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_25 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_25 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_25 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_27 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_27 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_27 | - | - |
| - | 4989930..4989992 | + | 63 | NuclAT_27 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_40 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_40 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_40 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_40 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_42 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_42 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_42 | - | - |
| - | 4989930..4989993 | + | 64 | NuclAT_42 | - | - |
| JMW01_RS23520 | 4990283..4991383 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| JMW01_RS23525 | 4991653..4991883 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| JMW01_RS23530 | 4992041..4992736 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JMW01_RS23535 | 4992780..4993133 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T290444 WP_000170965.1 NZ_LR890270:c4989342-4989235 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT290444 NZ_LR890270:4989390-4989456 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|