Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3931526..3932220 | Replicon | chromosome |
Accession | NZ_LR890270 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | V0YKG6 |
Locus tag | JMW01_RS18510 | Protein ID | WP_001263485.1 |
Coordinates | 3931822..3932220 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | JMW01_RS18505 | Protein ID | WP_000554758.1 |
Coordinates | 3931526..3931819 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS18485 | 3926842..3927339 | + | 498 | WP_000006263.1 | REP-associated tyrosine transposase RayT | - |
JMW01_RS18490 | 3927879..3929591 | - | 1713 | Protein_3602 | flagellar biosynthesis protein FlhA | - |
JMW01_RS18495 | 3929563..3930348 | + | 786 | WP_000207554.1 | putative lateral flagellar export/assembly protein LafU | - |
JMW01_RS18500 | 3930419..3931474 | + | 1056 | WP_001226177.1 | DNA polymerase IV | - |
JMW01_RS18505 | 3931526..3931819 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
JMW01_RS18510 | 3931822..3932220 | + | 399 | WP_001263485.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
JMW01_RS18515 | 3932230..3932682 | + | 453 | WP_001059899.1 | GNAT family N-acetyltransferase | - |
JMW01_RS18520 | 3932928..3933134 | + | 207 | Protein_3608 | RtcB family protein | - |
JMW01_RS18525 | 3933130..3933482 | + | 353 | Protein_3609 | peptide chain release factor H | - |
JMW01_RS18530 | 3933539..3934996 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
JMW01_RS18535 | 3935257..3935715 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
JMW01_RS18540 | 3935807..3937051 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
- | 3936311..3936391 | + | 81 | NuclAT_12 | - | - |
- | 3936311..3936391 | + | 81 | NuclAT_12 | - | - |
- | 3936311..3936391 | + | 81 | NuclAT_12 | - | - |
- | 3936311..3936391 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15418.84 Da Isoelectric Point: 7.3840
>T290439 WP_001263485.1 NZ_LR890270:3931822-3932220 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|