Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 126194..126565 | Replicon | chromosome |
| Accession | NZ_LR890270 | ||
| Organism | Escherichia coli isolate MINF_7C-sc-2280452 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | JMW01_RS00650 | Protein ID | WP_001317028.1 |
| Coordinates | 126371..126565 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 126194..126372 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW01_RS00625 | 122149..123522 | + | 1374 | WP_000123754.1 | ATP-dependent RNA helicase DbpA | - |
| JMW01_RS00630 | 123651..124586 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| JMW01_RS00635 | 124638..125873 | - | 1236 | WP_000040858.1 | site-specific integrase | - |
| JMW01_RS00640 | 125875..126090 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| JMW01_RS00645 | 126169..126378 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| - | 126194..126372 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 126194..126372 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 126194..126372 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 126194..126372 | + | 179 | NuclAT_0 | - | Antitoxin |
| JMW01_RS00650 | 126371..126565 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| JMW01_RS00655 | 126622..127431 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| JMW01_RS00660 | 127424..130024 | - | 2601 | WP_001586992.1 | exodeoxyribonuclease VIII | - |
| JMW01_RS00665 | 130126..130401 | - | 276 | WP_000632297.1 | protein RacC | - |
| JMW01_RS00670 | 130476..130646 | - | 171 | WP_001352098.1 | conserved protein, Rac prophage | - |
| JMW01_RS00675 | 130646..130867 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 124638..172191 | 47553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T290420 WP_001317028.1 NZ_LR890270:c126565-126371 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT290420 NZ_LR890270:126194-126372 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|