Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 5083054..5083651 | Replicon | chromosome |
| Accession | NZ_LR890254 | ||
| Organism | Klebsiella pneumoniae isolate INF310-sc-2280104 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | JMX51_RS24995 | Protein ID | WP_004142563.1 |
| Coordinates | 5083054..5083371 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | JMX51_RS25000 | Protein ID | WP_004142561.1 |
| Coordinates | 5083364..5083651 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX51_RS24980 | 5078754..5080181 | - | 1428 | WP_009308097.1 | MFS transporter | - |
| JMX51_RS24985 | 5080290..5081156 | + | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| JMX51_RS24990 | 5081826..5082869 | + | 1044 | WP_040153598.1 | DUF2157 domain-containing protein | - |
| JMX51_RS24995 | 5083054..5083371 | + | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX51_RS25000 | 5083364..5083651 | + | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| JMX51_RS25005 | 5083916..5084554 | - | 639 | WP_064277739.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| JMX51_RS25010 | 5084674..5085042 | - | 369 | WP_040171587.1 | MmcQ/YjbR family DNA-binding protein | - |
| JMX51_RS25015 | 5085039..5085623 | - | 585 | WP_094067239.1 | TetR/AcrR family transcriptional regulator | - |
| JMX51_RS25020 | 5085803..5086918 | + | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| JMX51_RS25025 | 5086949..5087290 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| JMX51_RS25030 | 5087308..5087556 | - | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T290411 WP_004142563.1 NZ_LR890254:5083054-5083371 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |