Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324659..325245 Replicon chromosome
Accession NZ_LR890235
Organism Klebsiella pneumoniae isolate INF334-sc-2280143

Toxin (Protein)


Gene name doc Uniprot ID A0A485R3H6
Locus tag JMV98_RS01505 Protein ID WP_032417643.1
Coordinates 324877..325245 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMV98_RS01500 Protein ID WP_004174006.1
Coordinates 324659..324880 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV98_RS01480 320816..321742 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMV98_RS01485 321739..323016 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMV98_RS01490 323013..323780 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMV98_RS01495 323782..324495 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMV98_RS01500 324659..324880 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMV98_RS01505 324877..325245 + 369 WP_032417643.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMV98_RS01510 325518..326834 + 1317 WP_032417642.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMV98_RS01515 326941..327828 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMV98_RS01520 327825..328670 + 846 WP_032416348.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMV98_RS01525 328672..329742 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321739..330479 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13584.98 Da        Isoelectric Point: 8.6410

>T290356 WP_032417643.1 NZ_LR890235:324877-325245 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRMLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT290356 WP_004174006.1 NZ_LR890235:324659-324880 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A485R3H6

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References