Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3799709..3800306 | Replicon | chromosome |
Accession | NZ_LR890217 | ||
Organism | Klebsiella pneumoniae isolate INF357-sc-2280189 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | JMV73_RS18580 | Protein ID | WP_101971099.1 |
Coordinates | 3799989..3800306 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | JMV73_RS18575 | Protein ID | WP_004142561.1 |
Coordinates | 3799709..3799996 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV73_RS18545 | 3795789..3796037 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
JMV73_RS18550 | 3796055..3796396 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
JMV73_RS18555 | 3796427..3797542 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
JMV73_RS18560 | 3797722..3798306 | + | 585 | WP_002893026.1 | TetR/AcrR family transcriptional regulator | - |
JMV73_RS18565 | 3798303..3798671 | + | 369 | WP_002893024.1 | MmcQ/YjbR family DNA-binding protein | - |
JMV73_RS18570 | 3798791..3799444 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
JMV73_RS18575 | 3799709..3799996 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMV73_RS18580 | 3799989..3800306 | - | 318 | WP_101971099.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV73_RS18585 | 3800491..3801534 | - | 1044 | WP_087761125.1 | DUF2157 domain-containing protein | - |
JMV73_RS18590 | 3802200..3803066 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
JMV73_RS18595 | 3803175..3804602 | + | 1428 | WP_004223482.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12076.37 Da Isoelectric Point: 11.2767
>T290332 WP_101971099.1 NZ_LR890217:c3800306-3799989 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLLLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLLLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|