Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 351315..351961 | Replicon | chromosome |
Accession | NZ_LR890217 | ||
Organism | Klebsiella pneumoniae isolate INF357-sc-2280189 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A231WWF9 |
Locus tag | JMV73_RS01620 | Protein ID | WP_004174016.1 |
Coordinates | 351315..351662 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A231WWU8 |
Locus tag | JMV73_RS01625 | Protein ID | WP_004174017.1 |
Coordinates | 351662..351961 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV73_RS01610 | 347241..348674 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
JMV73_RS01615 | 348692..351139 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
JMV73_RS01620 | 351315..351662 | + | 348 | WP_004174016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV73_RS01625 | 351662..351961 | + | 300 | WP_004174017.1 | XRE family transcriptional regulator | Antitoxin |
JMV73_RS01630 | 352024..353532 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
JMV73_RS01635 | 353737..354066 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
JMV73_RS01640 | 354117..354947 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
JMV73_RS01645 | 354997..355755 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.55 Da Isoelectric Point: 6.2327
>T290325 WP_004174016.1 NZ_LR890217:351315-351662 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A231WWF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A231WWU8 |