Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4298464..4299110 | Replicon | chromosome |
Accession | NZ_LR890202 | ||
Organism | Klebsiella pneumoniae isolate INF008-sc-2279879 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A6TF46 |
Locus tag | JMV80_RS20700 | Protein ID | WP_015959099.1 |
Coordinates | 4298464..4298811 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A231WWU8 |
Locus tag | JMV80_RS20705 | Protein ID | WP_004174017.1 |
Coordinates | 4298811..4299110 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV80_RS20690 | 4294390..4295823 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
JMV80_RS20695 | 4295841..4298288 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
JMV80_RS20700 | 4298464..4298811 | + | 348 | WP_015959099.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV80_RS20705 | 4298811..4299110 | + | 300 | WP_004174017.1 | XRE family transcriptional regulator | Antitoxin |
JMV80_RS20710 | 4299173..4300681 | - | 1509 | WP_015959098.1 | glycerol-3-phosphate dehydrogenase | - |
JMV80_RS20715 | 4300886..4301215 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
JMV80_RS20720 | 4301266..4302096 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
JMV80_RS20725 | 4302146..4302904 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13519.49 Da Isoelectric Point: 6.2327
>T290288 WP_015959099.1 NZ_LR890202:4298464-4298811 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMNTLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMNTLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6TF46 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A231WWU8 |