Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4272277..4272863 Replicon chromosome
Accession NZ_LR890202
Organism Klebsiella pneumoniae isolate INF008-sc-2279879

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMV80_RS20590 Protein ID WP_002920800.1
Coordinates 4272495..4272863 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag JMV80_RS20585 Protein ID WP_002920802.1
Coordinates 4272277..4272498 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV80_RS20565 4268434..4269360 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMV80_RS20570 4269357..4270634 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMV80_RS20575 4270631..4271398 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMV80_RS20580 4271400..4272113 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMV80_RS20585 4272277..4272498 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMV80_RS20590 4272495..4272863 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMV80_RS20595 4273136..4274452 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMV80_RS20600 4274559..4275446 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMV80_RS20605 4275443..4276288 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMV80_RS20610 4276290..4277360 + 1071 WP_004188298.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4269357..4278097 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T290287 WP_002920800.1 NZ_LR890202:4272495-4272863 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT290287 WP_002920802.1 NZ_LR890202:4272277-4272498 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References