Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 2479882..2480479 | Replicon | chromosome |
| Accession | NZ_LR890202 | ||
| Organism | Klebsiella pneumoniae isolate INF008-sc-2279879 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | JMV80_RS12075 | Protein ID | WP_004142563.1 |
| Coordinates | 2480162..2480479 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | JMV80_RS12070 | Protein ID | WP_004142561.1 |
| Coordinates | 2479882..2480169 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV80_RS12040 | 2475962..2476210 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| JMV80_RS12045 | 2476228..2476569 | - | 342 | WP_169555045.1 | RamA family antibiotic efflux transcriptional regulator | - |
| JMV80_RS12050 | 2476600..2477715 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| JMV80_RS12055 | 2477895..2478476 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| JMV80_RS12060 | 2478476..2478844 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| JMV80_RS12065 | 2478964..2479617 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| JMV80_RS12070 | 2479882..2480169 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| JMV80_RS12075 | 2480162..2480479 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV80_RS12080 | 2480664..2481707 | - | 1044 | WP_048336957.1 | DUF2157 domain-containing protein | - |
| JMV80_RS12085 | 2482373..2483239 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| JMV80_RS12090 | 2483348..2484775 | + | 1428 | WP_023300814.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T290281 WP_004142563.1 NZ_LR890202:c2480479-2480162 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |