Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 12447..13093 | Replicon | plasmid 4 |
| Accession | NZ_LR890201 | ||
| Organism | Escherichia coli isolate MINF_1D-sc-2280456 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | JMV89_RS25645 | Protein ID | WP_096956853.1 |
| Coordinates | 12743..13093 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | E9TBD4 |
| Locus tag | JMV89_RS25640 | Protein ID | WP_001259442.1 |
| Coordinates | 12447..12746 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV89_RS25600 | 7815..8123 | + | 309 | WP_000447215.1 | hypothetical protein | - |
| JMV89_RS25605 | 8189..8839 | + | 651 | WP_201520209.1 | hypothetical protein | - |
| JMV89_RS25610 | 9050..9535 | + | 486 | WP_001061740.1 | hypothetical protein | - |
| JMV89_RS25615 | 10113..10337 | + | 225 | WP_050418674.1 | hypothetical protein | - |
| JMV89_RS25620 | 10370..10720 | + | 351 | WP_000694583.1 | hypothetical protein | - |
| JMV89_RS25625 | 11040..11663 | + | 624 | WP_001127156.1 | ParA family protein | - |
| JMV89_RS25630 | 11660..11869 | + | 210 | WP_096956855.1 | hypothetical protein | - |
| JMV89_RS25635 | 11898..12389 | + | 492 | WP_000456858.1 | hypothetical protein | - |
| JMV89_RS25640 | 12447..12746 | - | 300 | WP_001259442.1 | XRE family transcriptional regulator | Antitoxin |
| JMV89_RS25645 | 12743..13093 | - | 351 | WP_096956853.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV89_RS25650 | 13451..13954 | + | 504 | WP_021526598.1 | hypothetical protein | - |
| JMV89_RS25655 | 14123..14491 | + | 369 | WP_001330915.1 | hypothetical protein | - |
| JMV89_RS25660 | 15059..15655 | - | 597 | WP_021528077.1 | hypothetical protein | - |
| JMV89_RS25665 | 15652..16179 | - | 528 | WP_001330917.1 | hypothetical protein | - |
| JMV89_RS25670 | 16191..16406 | + | 216 | WP_001280801.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..29794 | 29794 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13769.84 Da Isoelectric Point: 8.9197
>T290273 WP_096956853.1 NZ_LR890201:c13093-12743 [Escherichia coli]
MWTVYFGRLFDEWFEEQELALKRKVLAELRHLEKFGPSLSRPHADTVKGSRHKNMKELRIQYEGHPIRAFFAFDPIRQAI
ILCAGDKSNDKKFYDRMIRIADEEFSTHLAELEGKK
MWTVYFGRLFDEWFEEQELALKRKVLAELRHLEKFGPSLSRPHADTVKGSRHKNMKELRIQYEGHPIRAFFAFDPIRQAI
ILCAGDKSNDKKFYDRMIRIADEEFSTHLAELEGKK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|