Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 73071..73400 | Replicon | plasmid 2 |
Accession | NZ_LR890199 | ||
Organism | Escherichia coli isolate MINF_1D-sc-2280456 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | JMV89_RS24695 | Protein ID | WP_001312861.1 |
Coordinates | 73071..73229 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 73273..73400 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV89_RS24655 | 68183..68410 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
JMV89_RS24660 | 68498..69175 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
JMV89_RS24665 | 69309..69692 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
JMV89_RS24670 | 70023..70625 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
JMV89_RS24675 | 70922..71743 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
JMV89_RS24680 | 71862..72149 | - | 288 | WP_000107535.1 | hypothetical protein | - |
JMV89_RS24685 | 72174..72380 | - | 207 | WP_000275859.1 | hypothetical protein | - |
JMV89_RS24690 | 72293..72628 | - | 336 | WP_013023876.1 | hypothetical protein | - |
JMV89_RS24695 | 73071..73229 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 73273..73400 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 73273..73400 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 73273..73400 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 73273..73400 | - | 128 | NuclAT_0 | - | Antitoxin |
- | 74842..74944 | - | 103 | NuclAT_1 | - | - |
- | 74842..74944 | - | 103 | NuclAT_1 | - | - |
- | 74842..74944 | - | 103 | NuclAT_1 | - | - |
- | 74842..74944 | - | 103 | NuclAT_1 | - | - |
JMV89_RS24705 | 74956..75675 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
JMV89_RS24710 | 75672..76106 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
JMV89_RS24715 | 76161..78119 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / blaCTX-M-15 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..125802 | 125802 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290265 WP_001312861.1 NZ_LR890199:c73229-73071 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 128 bp
>AT290265 NZ_LR890199:c73400-73273 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|