Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48362..48601 | Replicon | plasmid 2 |
| Accession | NZ_LR890199 | ||
| Organism | Escherichia coli isolate MINF_1D-sc-2280456 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | JMV89_RS24555 | Protein ID | WP_023144756.1 |
| Coordinates | 48362..48496 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48541..48601 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV89_RS24520 | 44691..45548 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| JMV89_RS24525 | 45541..45615 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| JMV89_RS24530 | 45612..45746 | - | 135 | Protein_58 | protein CopA/IncA | - |
| JMV89_RS24535 | 45852..46004 | - | 153 | WP_072258247.1 | replication protein A | - |
| JMV89_RS24540 | 46085..47107 | + | 1023 | WP_000255944.1 | IS21-like element IS100 family transposase | - |
| JMV89_RS24545 | 47104..47886 | + | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| JMV89_RS24550 | 47955..48065 | - | 111 | Protein_62 | replication protein | - |
| JMV89_RS24555 | 48362..48496 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 48541..48601 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 48541..48601 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 48541..48601 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 48541..48601 | + | 61 | NuclAT_2 | - | Antitoxin |
| JMV89_RS24560 | 48568..48854 | - | 287 | Protein_64 | DUF2726 domain-containing protein | - |
| JMV89_RS24565 | 49367..49579 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| JMV89_RS24570 | 49710..50270 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| JMV89_RS24575 | 50325..51071 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / blaCTX-M-15 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..125802 | 125802 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T290264 WP_023144756.1 NZ_LR890199:c48496-48362 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT290264 NZ_LR890199:48541-48601 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|