Detailed information of TA system TA290264

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 48362..48601
• Replicon: plasmid 2
• Accession: NZ_LR890199
• Organism: Escherichia coli isolate MINF_1D-sc-2280456

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: JMV89_RS24555
• Protein ID: WP_023144756.1
• Coordinates: 48362..48496 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	48541..48601 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMV89_RS24520	44691..45548	-	858	WP_000130640.1	incFII family plasmid replication initiator RepA	-
JMV89_RS24525	45541..45615	-	75	WP_031943482.1	RepA leader peptide Tap	-
JMV89_RS24530	45612..45746	-	135	Protein_58	protein CopA/IncA	-
JMV89_RS24535	45852..46004	-	153	WP_072258247.1	replication protein A	-
JMV89_RS24540	46085..47107	+	1023	WP_000255944.1	IS21-like element IS100 family transposase	-
JMV89_RS24545	47104..47886	+	783	WP_001317493.1	IS21-like element IS100kyp family helper ATPase IstB	-
JMV89_RS24550	47955..48065	-	111	Protein_62	replication protein	-
JMV89_RS24555	48362..48496	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	48541..48601	+	61	NuclAT_2	-	Antitoxin
-	48541..48601	+	61	NuclAT_2	-	Antitoxin
-	48541..48601	+	61	NuclAT_2	-	Antitoxin
-	48541..48601	+	61	NuclAT_2	-	Antitoxin
JMV89_RS24560	48568..48854	-	287	Protein_64	DUF2726 domain-containing protein	-
JMV89_RS24565	49367..49579	-	213	WP_013023861.1	hypothetical protein	-
JMV89_RS24570	49710..50270	-	561	WP_000139341.1	fertility inhibition protein FinO	-
JMV89_RS24575	50325..51071	-	747	WP_000205718.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / blaCTX-M-15 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..125802	125802

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T290264 WP_023144756.1 NZ_LR890199:c48496-48362 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

Antitoxin

Nucleotide

• Length: 61 bp

>AT290264 NZ_LR890199:48541-48601 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin