Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3915838..3916532 | Replicon | chromosome |
| Accession | NZ_LR890198 | ||
| Organism | Escherichia coli isolate MINF_1D-sc-2280456 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | B7MQ69 |
| Locus tag | JMV89_RS18780 | Protein ID | WP_001263501.1 |
| Coordinates | 3915838..3916236 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | JMV89_RS18785 | Protein ID | WP_000554755.1 |
| Coordinates | 3916239..3916532 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV89_RS18755 | 3911203..3911661 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| JMV89_RS18760 | 3911922..3913379 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| JMV89_RS18765 | 3913436..3914050 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| JMV89_RS18770 | 3914047..3915186 | - | 1140 | WP_201520084.1 | RNA ligase RtcB family protein | - |
| JMV89_RS18775 | 3915376..3915828 | - | 453 | WP_001059897.1 | GNAT family N-acetyltransferase | - |
| JMV89_RS18780 | 3915838..3916236 | - | 399 | WP_001263501.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| JMV89_RS18785 | 3916239..3916532 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| JMV89_RS18790 | 3916584..3917639 | - | 1056 | WP_001226170.1 | DNA polymerase IV | - |
| JMV89_RS18795 | 3917710..3918495 | - | 786 | WP_000207543.1 | putative lateral flagellar export/assembly protein LafU | - |
| JMV89_RS18800 | 3918467..3920179 | + | 1713 | Protein_3687 | flagellar biosynthesis protein FlhA | - |
| JMV89_RS18805 | 3920207..3920701 | + | 495 | WP_139174989.1 | hypothetical protein | - |
| JMV89_RS18810 | 3920696..3921193 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0950
>T290256 WP_001263501.1 NZ_LR890198:c3916236-3915838 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376DBU4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |