Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 600746..601545 | Replicon | chromosome |
Accession | NZ_LR890198 | ||
Organism | Escherichia coli isolate MINF_1D-sc-2280456 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | JMV89_RS02915 | Protein ID | WP_000347251.1 |
Coordinates | 600746..601210 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | JMV89_RS02920 | Protein ID | WP_001296435.1 |
Coordinates | 601210..601545 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV89_RS02885 | 595747..596181 | - | 435 | WP_000948834.1 | PTS sugar transporter subunit IIA | - |
JMV89_RS02890 | 596199..597077 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JMV89_RS02895 | 597067..597846 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JMV89_RS02900 | 597857..598330 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JMV89_RS02905 | 598353..599633 | - | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JMV89_RS02910 | 599882..600691 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JMV89_RS02915 | 600746..601210 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JMV89_RS02920 | 601210..601545 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JMV89_RS02925 | 601694..603265 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
JMV89_RS02930 | 603640..604974 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
JMV89_RS02935 | 604990..605760 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T290242 WP_000347251.1 NZ_LR890198:c601210-600746 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |