Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2371207..2371896 | Replicon | chromosome |
Accession | NZ_LR890189 | ||
Organism | Klebsiella pneumoniae isolate INF133-sc-2279960 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | JMX29_RS11575 | Protein ID | WP_021469727.1 |
Coordinates | 2371207..2371524 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMX29_RS11580 | Protein ID | WP_040147778.1 |
Coordinates | 2371600..2371896 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX29_RS11545 | 2366909..2367418 | + | 510 | WP_002906702.1 | GNAT family N-acetyltransferase | - |
JMX29_RS11550 | 2367428..2368354 | + | 927 | WP_032416224.1 | amino acid ABC transporter permease | - |
JMX29_RS11555 | 2368338..2369117 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
JMX29_RS11560 | 2369156..2370007 | + | 852 | WP_014343117.1 | transporter substrate-binding domain-containing protein | - |
JMX29_RS11565 | 2370085..2370702 | + | 618 | WP_040147782.1 | glutathione S-transferase family protein | - |
JMX29_RS11570 | 2370773..2371000 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
JMX29_RS11575 | 2371207..2371524 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX29_RS11580 | 2371600..2371896 | + | 297 | WP_040147778.1 | helix-turn-helix domain-containing protein | Antitoxin |
JMX29_RS11585 | 2371975..2372421 | + | 447 | WP_004175959.1 | hypothetical protein | - |
JMX29_RS11590 | 2372462..2374078 | - | 1617 | WP_040147777.1 | carbohydrate porin | - |
JMX29_RS11595 | 2374122..2375504 | - | 1383 | WP_099743292.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T290231 WP_021469727.1 NZ_LR890189:2371207-2371524 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|