Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3758546..3759240 Replicon chromosome
Accession NZ_LR883050
Organism Escherichia coli isolate L1_E925

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag JL017_RS18320 Protein ID WP_001263493.1
Coordinates 3758546..3758944 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag JL017_RS18325 Protein ID WP_000554757.1
Coordinates 3758947..3759240 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL017_RS18290 3753546..3754790 - 1245 WP_047648217.1 esterase FrsA -
- 3754206..3754286 - 81 NuclAT_12 - -
- 3754206..3754286 - 81 NuclAT_12 - -
- 3754206..3754286 - 81 NuclAT_12 - -
- 3754206..3754286 - 81 NuclAT_12 - -
JL017_RS18295 3754882..3755340 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JL017_RS18300 3755601..3757058 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
JL017_RS18305 3757115..3757636 - 522 Protein_3582 peptide chain release factor H -
JL017_RS18310 3757635..3757838 - 204 Protein_3583 RNA ligase RtcB family protein -
JL017_RS18315 3758084..3758536 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
JL017_RS18320 3758546..3758944 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JL017_RS18325 3758947..3759240 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JL017_RS18330 3759292..3760347 - 1056 WP_001226164.1 DNA polymerase IV -
JL017_RS18335 3760418..3761341 - 924 WP_001232570.1 putative lateral flagellar export/assembly protein LafU -
JL017_RS18340 3761344..3762207 - 864 WP_001169518.1 flagellar motor stator protein MotA -
JL017_RS18345 3762220..3762939 - 720 WP_000938740.1 FliA/WhiG family RNA polymerase sigma factor -
JL017_RS18350 3762959..3763425 - 467 Protein_3591 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T290158 WP_001263493.1 NZ_LR883050:c3758944-3758546 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT290158 WP_000554757.1 NZ_LR883050:c3759240-3758947 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References