Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 61251..61668 | Replicon | plasmid 3 |
| Accession | NZ_LR883014 | ||
| Organism | Escherichia coli isolate L4_E1441_ETEC | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JLZ95_RS24645 | Protein ID | WP_001312861.1 |
| Coordinates | 61251..61409 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 61474..61668 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ95_RS24615 | 56764..57111 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JLZ95_RS24620 | 57111..57788 | - | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| JLZ95_RS24625 | 57841..58032 | - | 192 | Protein_58 | hypothetical protein | - |
| JLZ95_RS24630 | 58342..59019 | + | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| JLZ95_RS24635 | 59019..59366 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JLZ95_RS24640 | 59386..60957 | + | 1572 | WP_099554548.1 | IS66 family transposase | - |
| JLZ95_RS24645 | 61251..61409 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 61474..61668 | - | 195 | NuclAT_0 | - | Antitoxin |
| - | 61474..61668 | - | 195 | NuclAT_0 | - | Antitoxin |
| - | 61474..61668 | - | 195 | NuclAT_0 | - | Antitoxin |
| - | 61474..61668 | - | 195 | NuclAT_0 | - | Antitoxin |
| JLZ95_RS24650 | 61680..62399 | - | 720 | WP_001734594.1 | plasmid SOS inhibition protein A | - |
| JLZ95_RS24655 | 62396..62830 | - | 435 | WP_000845954.1 | conjugation system SOS inhibitor PsiB | - |
| JLZ95_RS24660 | 62885..64848 | - | 1964 | Protein_65 | ParB/RepB/Spo0J family partition protein | - |
| JLZ95_RS24665 | 64910..65470 | + | 561 | Protein_66 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | eltA / eltB / espC / cssA | 1..94840 | 94840 | |
| - | inside | IScluster/Tn | - | espC / cssA | 41145..71609 | 30464 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290142 WP_001312861.1 NZ_LR883014:c61409-61251 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 195 bp
>AT290142 NZ_LR883014:c61668-61474 [Escherichia coli]
TCACGCGGATTTCCCGTAGCCTGAATGAGCGTATTCTTTTCAGGAAAAGTGAATGTGGCCAGCGTGCAGGGATATGAGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGCAGAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACGCGGATTTCCCGTAGCCTGAATGAGCGTATTCTTTTCAGGAAAAGTGAATGTGGCCAGCGTGCAGGGATATGAGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGCAGAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|