Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3844015..3844709 Replicon chromosome
Accession NZ_LR883012
Organism Escherichia coli isolate L4_E1441_ETEC

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag JLZ95_RS18735 Protein ID WP_001263493.1
Coordinates 3844015..3844413 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag JLZ95_RS18740 Protein ID WP_000554757.1
Coordinates 3844416..3844709 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLZ95_RS18705 3839015..3840259 - 1245 WP_000189541.1 esterase FrsA -
- 3839675..3839755 - 81 NuclAT_11 - -
- 3839675..3839755 - 81 NuclAT_11 - -
- 3839675..3839755 - 81 NuclAT_11 - -
- 3839675..3839755 - 81 NuclAT_11 - -
JLZ95_RS18710 3840351..3840809 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JLZ95_RS18715 3841070..3842527 + 1458 WP_001293002.1 cytosol nonspecific dipeptidase -
JLZ95_RS18720 3842584..3843105 - 522 Protein_3664 peptide chain release factor H -
JLZ95_RS18725 3843104..3843307 - 204 Protein_3665 RNA ligase RtcB family protein -
JLZ95_RS18730 3843553..3844005 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
JLZ95_RS18735 3844015..3844413 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JLZ95_RS18740 3844416..3844709 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JLZ95_RS18745 3844761..3845816 - 1056 WP_001226164.1 DNA polymerase IV -
JLZ95_RS18750 3845887..3846672 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
JLZ95_RS18755 3846644..3848356 + 1713 Protein_3671 flagellar biosynthesis protein FlhA -
JLZ95_RS18760 3848580..3849077 - 498 WP_000006242.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T290134 WP_001263493.1 NZ_LR883012:c3844413-3844015 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT290134 WP_000554757.1 NZ_LR883012:c3844709-3844416 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References