Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3844015..3844709 | Replicon | chromosome |
| Accession | NZ_LR883012 | ||
| Organism | Escherichia coli isolate L4_E1441_ETEC | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | JLZ95_RS18735 | Protein ID | WP_001263493.1 |
| Coordinates | 3844015..3844413 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | JLZ95_RS18740 | Protein ID | WP_000554757.1 |
| Coordinates | 3844416..3844709 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ95_RS18705 | 3839015..3840259 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3839675..3839755 | - | 81 | NuclAT_11 | - | - |
| - | 3839675..3839755 | - | 81 | NuclAT_11 | - | - |
| - | 3839675..3839755 | - | 81 | NuclAT_11 | - | - |
| - | 3839675..3839755 | - | 81 | NuclAT_11 | - | - |
| JLZ95_RS18710 | 3840351..3840809 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| JLZ95_RS18715 | 3841070..3842527 | + | 1458 | WP_001293002.1 | cytosol nonspecific dipeptidase | - |
| JLZ95_RS18720 | 3842584..3843105 | - | 522 | Protein_3664 | peptide chain release factor H | - |
| JLZ95_RS18725 | 3843104..3843307 | - | 204 | Protein_3665 | RNA ligase RtcB family protein | - |
| JLZ95_RS18730 | 3843553..3844005 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| JLZ95_RS18735 | 3844015..3844413 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| JLZ95_RS18740 | 3844416..3844709 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| JLZ95_RS18745 | 3844761..3845816 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| JLZ95_RS18750 | 3845887..3846672 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| JLZ95_RS18755 | 3846644..3848356 | + | 1713 | Protein_3671 | flagellar biosynthesis protein FlhA | - |
| JLZ95_RS18760 | 3848580..3849077 | - | 498 | WP_000006242.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T290134 WP_001263493.1 NZ_LR883012:c3844413-3844015 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|