Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 675043..675770 | Replicon | chromosome |
| Accession | NZ_LR883012 | ||
| Organism | Escherichia coli isolate L4_E1441_ETEC | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | JLZ95_RS03260 | Protein ID | WP_000550189.1 |
| Coordinates | 675043..675357 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JLZ95_RS03265 | Protein ID | WP_000560266.1 |
| Coordinates | 675354..675770 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ95_RS03240 | 671201..672187 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
| JLZ95_RS03245 | 672266..672958 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
| JLZ95_RS03250 | 673035..673538 | - | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
| JLZ95_RS03255 | 673623..674759 | + | 1137 | WP_001735755.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| JLZ95_RS03260 | 675043..675357 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| JLZ95_RS03265 | 675354..675770 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| JLZ95_RS03270 | 675815..677833 | - | 2019 | WP_001735754.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| JLZ95_RS03275 | 678259..680610 | - | 2352 | WP_000695487.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T290122 WP_000550189.1 NZ_LR883012:675043-675357 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT290122 WP_000560266.1 NZ_LR883012:675354-675770 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|