Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 631825..632624 | Replicon | chromosome |
Accession | NZ_LR883012 | ||
Organism | Escherichia coli isolate L4_E1441_ETEC |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | JLZ95_RS03040 | Protein ID | WP_000347273.1 |
Coordinates | 631825..632289 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | JLZ95_RS03045 | Protein ID | WP_005762317.1 |
Coordinates | 632289..632624 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ95_RS03010 | 626826..627260 | - | 435 | WP_000948842.1 | PTS sugar transporter subunit IIA | - |
JLZ95_RS03015 | 627278..628156 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JLZ95_RS03020 | 628146..628925 | - | 780 | WP_000406208.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JLZ95_RS03025 | 628936..629409 | - | 474 | WP_001735764.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JLZ95_RS03030 | 629432..630712 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JLZ95_RS03035 | 630961..631770 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JLZ95_RS03040 | 631825..632289 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JLZ95_RS03045 | 632289..632624 | - | 336 | WP_005762317.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JLZ95_RS03050 | 632773..634344 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
JLZ95_RS03055 | 634719..636038 | + | 1320 | WP_001735763.1 | galactarate/glucarate/glycerate transporter GarP | - |
JLZ95_RS03060 | 636054..636824 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T290121 WP_000347273.1 NZ_LR883012:c632289-631825 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|