Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4777712..4778314 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | JL014_RS23215 | Protein ID | WP_000897305.1 |
Coordinates | 4778003..4778314 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JL014_RS23210 | Protein ID | WP_000356397.1 |
Coordinates | 4777712..4778002 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS23185 | 4773638..4774540 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
JL014_RS23190 | 4774537..4775172 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
JL014_RS23195 | 4775169..4776098 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
JL014_RS23200 | 4776428..4776670 | - | 243 | WP_001086388.1 | hypothetical protein | - |
JL014_RS23205 | 4776889..4777107 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
JL014_RS23210 | 4777712..4778002 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
JL014_RS23215 | 4778003..4778314 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
JL014_RS23220 | 4778543..4779451 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
JL014_RS23225 | 4779515..4780456 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
JL014_RS23230 | 4780501..4780938 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JL014_RS23235 | 4780935..4781807 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
JL014_RS23240 | 4781801..4782400 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
JL014_RS23245 | 4782499..4783284 | - | 786 | WP_001662158.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T290116 WP_000897305.1 NZ_LR883006:c4778314-4778003 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|