Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4251598..4252010 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A3W4M8W4 |
Locus tag | JL014_RS20735 | Protein ID | WP_000132864.1 |
Coordinates | 4251669..4252010 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4251598..4251674 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS20725 | 4248542..4250131 | + | 1590 | WP_001063214.1 | type I restriction-modification system methyltransferase | - |
JL014_RS20730 | 4250128..4251441 | + | 1314 | WP_000042302.1 | restriction endonuclease subunit S | - |
- | 4251598..4251674 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_14 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_15 | - | Antitoxin |
- | 4251598..4251674 | - | 77 | NuclAT_15 | - | Antitoxin |
JL014_RS20735 | 4251669..4252010 | + | 342 | WP_000132864.1 | endoribonuclease SymE | Toxin |
JL014_RS20740 | 4252053..4256912 | - | 4860 | Protein_4054 | DUF1998 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12254.06 Da Isoelectric Point: 7.8817
>T290111 WP_000132864.1 NZ_LR883006:4251669-4252010 [Escherichia coli]
MTDTYSIAQPFEAEVSPANNRHVTVGYASRYPDHAHIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRRVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTYSIAQPFEAEVSPANNRHVTVGYASRYPDHAHIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRRVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT290111 NZ_LR883006:c4251674-4251598 [Escherichia coli]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|