Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2894569..2894794 | Replicon | chromosome |
| Accession | NZ_LR883006 | ||
| Organism | Escherichia coli isolate L5_E1779_ETEC | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | JL014_RS14210 | Protein ID | WP_000813254.1 |
| Coordinates | 2894569..2894724 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2894736..2894794 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL014_RS14170 | 2890380..2890577 | - | 198 | WP_000917767.1 | hypothetical protein | - |
| JL014_RS14175 | 2890890..2891432 | - | 543 | WP_001398904.1 | DUF1133 family protein | - |
| JL014_RS14180 | 2891441..2891806 | - | 366 | WP_001297842.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JL014_RS14185 | 2891807..2892862 | - | 1056 | WP_001502278.1 | DUF968 domain-containing protein | - |
| JL014_RS14190 | 2892864..2893142 | - | 279 | WP_023607105.1 | hypothetical protein | - |
| JL014_RS14195 | 2893209..2893469 | - | 261 | WP_000701918.1 | hypothetical protein | - |
| JL014_RS14200 | 2893670..2894155 | - | 486 | WP_000818165.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| JL014_RS14205 | 2894174..2894353 | - | 180 | WP_001277775.1 | hypothetical protein | - |
| JL014_RS14210 | 2894569..2894724 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2894736..2894794 | + | 59 | - | - | Antitoxin |
| JL014_RS14215 | 2895016..2895438 | - | 423 | WP_000160146.1 | hypothetical protein | - |
| JL014_RS14220 | 2895542..2895954 | - | 413 | Protein_2783 | DUF4406 domain-containing protein | - |
| JL014_RS14225 | 2895957..2896238 | - | 282 | WP_001509842.1 | hypothetical protein | - |
| JL014_RS14230 | 2896271..2897032 | - | 762 | WP_000450703.1 | DUF1627 domain-containing protein | - |
| JL014_RS14235 | 2897054..2897800 | - | 747 | WP_000788772.1 | ATP-binding protein | - |
| JL014_RS14240 | 2897806..2898771 | - | 966 | WP_000054517.1 | hypothetical protein | - |
| JL014_RS14245 | 2898752..2899273 | - | 522 | WP_000705382.1 | hypothetical protein | - |
| JL014_RS14250 | 2899257..2899484 | - | 228 | WP_000476985.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2855445..2913426 | 57981 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T290107 WP_000813254.1 NZ_LR883006:c2894724-2894569 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT290107 NZ_LR883006:2894736-2894794 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
