Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2735277..2735502 Replicon chromosome
Accession NZ_LR883006
Organism Escherichia coli isolate L5_E1779_ETEC

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag JL014_RS13330 Protein ID WP_000813254.1
Coordinates 2735277..2735432 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2735444..2735502 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL014_RS13280 2730323..2730484 - 162 WP_001355909.1 hypothetical protein -
JL014_RS13285 2730481..2730669 - 189 WP_000874243.1 DUF1737 domain-containing protein -
JL014_RS13290 2730930..2731265 + 336 WP_000871291.1 anti-adapter protein IraM -
JL014_RS13295 2731546..2731677 - 132 WP_000562553.1 DUF3927 family protein -
JL014_RS13310 2732573..2733394 - 822 WP_000762892.1 antitermination protein -
JL014_RS13315 2733391..2733771 - 381 WP_000140028.1 RusA family crossover junction endodeoxyribonuclease -
JL014_RS13320 2733772..2734830 - 1059 WP_001736257.1 DUF968 domain-containing protein -
JL014_RS13325 2734832..2735110 - 279 WP_001410105.1 hypothetical protein -
JL014_RS13330 2735277..2735432 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2735444..2735502 + 59 - - Antitoxin
JL014_RS13335 2736057..2736866 + 810 WP_000161640.1 hypothetical protein -
JL014_RS13340 2737013..2737435 - 423 WP_001151221.1 DUF977 family protein -
JL014_RS13345 2737476..2738546 - 1071 WP_089516821.1 phage replisome organizer -
JL014_RS13350 2738618..2739043 - 426 WP_000693867.1 Rha family transcriptional regulator -
JL014_RS13355 2739027..2739270 - 244 Protein_2616 hypothetical protein -
JL014_RS13360 2739662..2740000 + 339 WP_001397087.1 peptidase S24-like family protein -
JL014_RS13365 2740293..2740448 + 156 WP_071608135.1 DUF1391 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2702278..2749891 47613


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T290106 WP_000813254.1 NZ_LR883006:c2735432-2735277 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT290106 NZ_LR883006:2735444-2735502 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References