Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2362516..2362741 Replicon chromosome
Accession NZ_LR883006
Organism Escherichia coli isolate L5_E1779_ETEC

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag JL014_RS11525 Protein ID WP_000813254.1
Coordinates 2362586..2362741 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2362516..2362574 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL014_RS11505 2357981..2359258 + 1278 WP_000625667.1 DUF2254 domain-containing protein -
JL014_RS11510 2359541..2360236 - 696 WP_032190252.1 hypothetical protein -
JL014_RS11515 2360239..2360745 - 507 WP_000130123.1 hypothetical protein -
JL014_RS11520 2360742..2361572 - 831 WP_001399639.1 ParA family protein -
- 2362516..2362574 - 59 - - Antitoxin
JL014_RS11525 2362586..2362741 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
JL014_RS11530 2362908..2363186 + 279 WP_001410105.1 hypothetical protein -
JL014_RS11535 2363188..2364234 + 1047 WP_001265103.1 DUF968 domain-containing protein -
JL014_RS11540 2364247..2364618 + 372 WP_001217451.1 RusA family crossover junction endodeoxyribonuclease -
JL014_RS11545 2364608..2364961 + 354 WP_000532207.1 antitermination protein Q -
JL014_RS11550 2365168..2366451 - 1284 WP_000123148.1 hypothetical protein -
JL014_RS11555 2366708..2366902 + 195 WP_001355891.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2331638..2400249 68611


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T290104 WP_000813254.1 NZ_LR883006:2362586-2362741 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT290104 NZ_LR883006:c2362574-2362516 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References