Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 600186..600985 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | JL014_RS02910 | Protein ID | WP_000347267.1 |
Coordinates | 600186..600650 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | JL014_RS02915 | Protein ID | WP_001307405.1 |
Coordinates | 600650..600985 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS02880 | 595187..595621 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
JL014_RS02885 | 595639..596517 | - | 879 | WP_001355782.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JL014_RS02890 | 596507..597286 | - | 780 | WP_000406212.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JL014_RS02895 | 597297..597770 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JL014_RS02900 | 597793..599073 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JL014_RS02905 | 599322..600131 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JL014_RS02910 | 600186..600650 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JL014_RS02915 | 600650..600985 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JL014_RS02920 | 601134..602705 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
JL014_RS02925 | 603080..604414 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
JL014_RS02930 | 604430..605200 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T290093 WP_000347267.1 NZ_LR883006:c600650-600186 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |