Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 336692..337104 | Replicon | plasmid 2 |
Accession | NZ_LR882998 | ||
Organism | Escherichia coli isolate L3_E36_ETEC |
Toxin (Protein)
Gene name | hok | Uniprot ID | A0A2H4TK50 |
Locus tag | JL022_RS27055 | Protein ID | WP_000775237.1 |
Coordinates | 336943..337104 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 336692..336897 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL022_RS27025 | 332374..332901 | + | 528 | WP_000290790.1 | single-stranded DNA-binding protein | - |
JL022_RS27030 | 332958..333191 | + | 234 | WP_000005971.1 | DUF905 domain-containing protein | - |
JL022_RS27035 | 333255..335219 | + | 1965 | WP_001759171.1 | ParB/RepB/Spo0J family partition protein | - |
JL022_RS27040 | 335274..335708 | + | 435 | WP_000845950.1 | conjugation system SOS inhibitor PsiB | - |
JL022_RS27045 | 335705..336424 | + | 720 | WP_099481790.1 | plasmid SOS inhibition protein A | - |
JL022_RS27050 | 336421..336735 | + | 315 | WP_000872086.1 | hypothetical protein | - |
- | 336692..336897 | + | 206 | NuclAT_2 | - | Antitoxin |
- | 336692..336897 | + | 206 | NuclAT_2 | - | Antitoxin |
- | 336692..336897 | + | 206 | NuclAT_2 | - | Antitoxin |
- | 336692..336897 | + | 206 | NuclAT_2 | - | Antitoxin |
JL022_RS27055 | 336943..337104 | + | 162 | WP_000775237.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JL022_RS27060 | 337342..337720 | - | 379 | Protein_406 | hypothetical protein | - |
JL022_RS27065 | 338016..338339 | + | 324 | WP_000533253.1 | hypothetical protein | - |
JL022_RS27070 | 338398..338640 | + | 243 | WP_000540588.1 | hypothetical protein | - |
JL022_RS27075 | 338906..339154 | + | 249 | WP_071606928.1 | hypothetical protein | - |
JL022_RS27080 | 339622..339918 | + | 297 | WP_001272251.1 | hypothetical protein | - |
JL022_RS27085 | 340029..340850 | + | 822 | WP_001234441.1 | DUF945 domain-containing protein | - |
JL022_RS27090 | 341147..341737 | - | 591 | WP_126728383.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | eltB / eltA / cofA / etpA / etpB / cfaA / cfaB / cfaC / cfaE / cfaD' | 1..381858 | 381858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 5946.16 Da Isoelectric Point: 8.5101
>T290087 WP_000775237.1 NZ_LR882998:336943-337104 [Escherichia coli]
MKLPGNALIWCVLIVCCTLLIFTLLTRNRLCEVRLKDGYREVTASLAYESGGK
MKLPGNALIWCVLIVCCTLLIFTLLTRNRLCEVRLKDGYREVTASLAYESGGK
Download Length: 162 bp
Antitoxin
Download Length: 206 bp
>AT290087 NZ_LR882998:336692-336897 [Escherichia coli]
CCCGTGAACTGGCTGAACGACCGGATTATTTTCAGGGAAAGTGAATGTGGTCAGCGTGCTGGTATATGGGCTATGATGTG
CCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGACAAAAGCCCCGT
AGTTAATTTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
CCCGTGAACTGGCTGAACGACCGGATTATTTTCAGGGAAAGTGAATGTGGTCAGCGTGCTGGTATATGGGCTATGATGTG
CCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGACAAAAGCCCCGT
AGTTAATTTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|