Detailed information of TA system TA290084

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 151508..151777
• Replicon: plasmid 2
• Accession: NZ_LR882998
• Organism: Escherichia coli isolate L3_E36_ETEC

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: JL022_RS26000
• Protein ID: WP_001312861.1
• Coordinates: 151619..151777 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	151508..151573 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JL022_RS25970	147277..147804	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
JL022_RS25975	147862..148095	+	234	WP_000006003.1	DUF905 family protein	-
JL022_RS25980	148156..150120	+	1965	WP_032327613.1	ParB/RepB/Spo0J family partition protein	-
JL022_RS25985	150189..150623	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
JL022_RS25990	150620..151339	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	151351..151575	+	225	NuclAT_0	-	-
-	151351..151575	+	225	NuclAT_0	-	-
-	151351..151575	+	225	NuclAT_0	-	-
-	151351..151575	+	225	NuclAT_0	-	-
JL022_RS25995	151360..151539	-	180	WP_001309233.1	hypothetical protein	-
-	151508..151573	-	66	-	-	Antitoxin
JL022_RS26000	151619..151777	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
JL022_RS26005	152078..152282	-	205	Protein_195	pilus protein	-
JL022_RS26010	152674..152970	+	297	WP_001272251.1	hypothetical protein	-
JL022_RS26015	153080..153901	+	822	WP_001234445.1	DUF945 domain-containing protein	-
JL022_RS26020	154198..154800	-	603	Protein_198	transglycosylase SLT domain-containing protein	-
JL022_RS26025	155121..155504	+	384	WP_001151538.1	relaxosome protein TraM	-
JL022_RS26030	155691..156380	+	690	WP_000283387.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltB / eltA / cofA / etpA / etpB / cfaA / cfaB / cfaC / cfaE / cfaD'	1..381858	381858

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T290084 WP_001312861.1 NZ_LR882998:151619-151777 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT290084 NZ_LR882998:c151573-151508 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin