Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 151351..151777 | Replicon | plasmid 2 |
Accession | NZ_LR882998 | ||
Organism | Escherichia coli isolate L3_E36_ETEC |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | JL022_RS26000 | Protein ID | WP_001312861.1 |
Coordinates | 151619..151777 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 151351..151575 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL022_RS25965 | 146502..146975 | - | 474 | WP_200995773.1 | hypothetical protein | - |
JL022_RS25970 | 147277..147804 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
JL022_RS25975 | 147862..148095 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
JL022_RS25980 | 148156..150120 | + | 1965 | WP_032327613.1 | ParB/RepB/Spo0J family partition protein | - |
JL022_RS25985 | 150189..150623 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
JL022_RS25990 | 150620..151339 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 151351..151575 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 151351..151575 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 151351..151575 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 151351..151575 | + | 225 | NuclAT_0 | - | Antitoxin |
JL022_RS25995 | 151360..151539 | - | 180 | WP_001309233.1 | hypothetical protein | - |
JL022_RS26000 | 151619..151777 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JL022_RS26005 | 152078..152282 | - | 205 | Protein_195 | pilus protein | - |
JL022_RS26010 | 152674..152970 | + | 297 | WP_001272251.1 | hypothetical protein | - |
JL022_RS26015 | 153080..153901 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
JL022_RS26020 | 154198..154800 | - | 603 | Protein_198 | transglycosylase SLT domain-containing protein | - |
JL022_RS26025 | 155121..155504 | + | 384 | WP_001151538.1 | relaxosome protein TraM | - |
JL022_RS26030 | 155691..156380 | + | 690 | WP_000283387.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | eltB / eltA / cofA / etpA / etpB / cfaA / cfaB / cfaC / cfaE / cfaD' | 1..381858 | 381858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290083 WP_001312861.1 NZ_LR882998:151619-151777 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT290083 NZ_LR882998:151351-151575 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|