Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4950366..4950968 | Replicon | chromosome |
Accession | NZ_LR882997 | ||
Organism | Escherichia coli isolate L3_E36_ETEC |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | JL022_RS24075 | Protein ID | WP_000897305.1 |
Coordinates | 4950657..4950968 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JL022_RS24070 | Protein ID | WP_000356397.1 |
Coordinates | 4950366..4950656 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL022_RS24045 | 4946292..4947194 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
JL022_RS24050 | 4947191..4947826 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
JL022_RS24055 | 4947823..4948752 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
JL022_RS24060 | 4949082..4949324 | - | 243 | WP_001086388.1 | hypothetical protein | - |
JL022_RS24065 | 4949543..4949761 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
JL022_RS24070 | 4950366..4950656 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
JL022_RS24075 | 4950657..4950968 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
JL022_RS24080 | 4951197..4952105 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
JL022_RS24085 | 4952169..4953110 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
JL022_RS24090 | 4953155..4953592 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JL022_RS24095 | 4953589..4954461 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
JL022_RS24100 | 4954455..4955054 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
JL022_RS24105 | 4955153..4955938 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T290077 WP_000897305.1 NZ_LR882997:c4950968-4950657 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|