Detailed information of TA system TA290039

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 59967..60231
• Replicon: plasmid 2
• Accession: NZ_LR882979
• Organism: Escherichia coli isolate L3_CS7_E2980

Toxin (Protein)

• Gene name: pndA
• Uniprot ID: -
• Locus tag: JLZ94_RS24530
• Protein ID: WP_001704300.1
• Coordinates: 60079..60231 (+)
• Length: 51 a.a.

Antitoxin (RNA)

Gene name	pndB
Locus tag	-
Coordinates	59967..60029 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JLZ94_RS24515	56010..57080	-	1071	WP_000151586.1	IncI1-type conjugal transfer protein TrbB	-
JLZ94_RS24520	57099..58307	-	1209	WP_001388819.1	IncI1-type conjugal transfer protein TrbA	-
JLZ94_RS24525	58524..59510	-	987	WP_200999713.1	hypothetical protein	-
-	59671..59726	-	56	NuclAT_1	-	-
-	59671..59726	-	56	NuclAT_1	-	-
-	59671..59726	-	56	NuclAT_1	-	-
-	59671..59726	-	56	NuclAT_1	-	-
-	59967..60029	-	63	NuclAT_0	-	Antitoxin
-	59967..60029	-	63	NuclAT_0	-	Antitoxin
-	59967..60029	-	63	NuclAT_0	-	Antitoxin
-	59967..60029	-	63	NuclAT_0	-	Antitoxin
JLZ94_RS24530	60079..60231	+	153	WP_001704300.1	Hok/Gef family protein	Toxin
JLZ94_RS24535	60303..60554	-	252	WP_001291963.1	hypothetical protein	-
JLZ94_RS24540	60854..61150	+	297	WP_001275298.1	hypothetical protein	-
JLZ94_RS24545	61215..61391	-	177	WP_001054897.1	hypothetical protein	-
JLZ94_RS24550	61600..61809	-	210	WP_000416064.1	hemolysin expression modulator Hha	-
JLZ94_RS24555	61907..62505	-	599	Protein_72	plasmid IncI1-type surface exclusion protein ExcA	-
JLZ94_RS24560	62581..64749	-	2169	WP_001388820.1	IncI1-type conjugal transfer membrane protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	csvA / eltB / eltA	1..112055	112055

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (7-46)

Sequences

Toxin

Protein

• Length: 51 a.a.
• Molecular weight: 5809.14 Da
• Isoelectric Point: 8.7948

>T290039 WP_001704300.1 NZ_LR882979:60079-60231 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVFVATLAYEVKR

Nucleotide

• Length: 153 bp

Antitoxin

Nucleotide

• Length: 63 bp

>AT290039 NZ_LR882979:c60029-59967 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Structures

Antitoxin