Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59967..60231 | Replicon | plasmid 2 |
| Accession | NZ_LR882979 | ||
| Organism | Escherichia coli isolate L3_CS7_E2980 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | - |
| Locus tag | JLZ94_RS24530 | Protein ID | WP_001704300.1 |
| Coordinates | 60079..60231 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 59967..60029 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ94_RS24515 | 56010..57080 | - | 1071 | WP_000151586.1 | IncI1-type conjugal transfer protein TrbB | - |
| JLZ94_RS24520 | 57099..58307 | - | 1209 | WP_001388819.1 | IncI1-type conjugal transfer protein TrbA | - |
| JLZ94_RS24525 | 58524..59510 | - | 987 | WP_200999713.1 | hypothetical protein | - |
| - | 59671..59726 | - | 56 | NuclAT_1 | - | - |
| - | 59671..59726 | - | 56 | NuclAT_1 | - | - |
| - | 59671..59726 | - | 56 | NuclAT_1 | - | - |
| - | 59671..59726 | - | 56 | NuclAT_1 | - | - |
| - | 59967..60029 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 59967..60029 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 59967..60029 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 59967..60029 | - | 63 | NuclAT_0 | - | Antitoxin |
| JLZ94_RS24530 | 60079..60231 | + | 153 | WP_001704300.1 | Hok/Gef family protein | Toxin |
| JLZ94_RS24535 | 60303..60554 | - | 252 | WP_001291963.1 | hypothetical protein | - |
| JLZ94_RS24540 | 60854..61150 | + | 297 | WP_001275298.1 | hypothetical protein | - |
| JLZ94_RS24545 | 61215..61391 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| JLZ94_RS24550 | 61600..61809 | - | 210 | WP_000416064.1 | hemolysin expression modulator Hha | - |
| JLZ94_RS24555 | 61907..62505 | - | 599 | Protein_72 | plasmid IncI1-type surface exclusion protein ExcA | - |
| JLZ94_RS24560 | 62581..64749 | - | 2169 | WP_001388820.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | csvA / eltB / eltA | 1..112055 | 112055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5809.14 Da Isoelectric Point: 8.7948
>T290039 WP_001704300.1 NZ_LR882979:60079-60231 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVFVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVFVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT290039 NZ_LR882979:c60029-59967 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|