Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4791543..4792145 | Replicon | chromosome |
Accession | NZ_LR882978 | ||
Organism | Escherichia coli isolate L3_CS7_E2980 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | JLZ94_RS23240 | Protein ID | WP_000897305.1 |
Coordinates | 4791834..4792145 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JLZ94_RS23235 | Protein ID | WP_000356397.1 |
Coordinates | 4791543..4791833 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ94_RS23210 | 4787469..4788371 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
JLZ94_RS23215 | 4788368..4789003 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
JLZ94_RS23220 | 4789000..4789929 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
JLZ94_RS23225 | 4790259..4790501 | - | 243 | WP_001086388.1 | hypothetical protein | - |
JLZ94_RS23230 | 4790720..4790938 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
JLZ94_RS23235 | 4791543..4791833 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
JLZ94_RS23240 | 4791834..4792145 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
JLZ94_RS23245 | 4792374..4793282 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
JLZ94_RS23250 | 4793346..4794287 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
JLZ94_RS23255 | 4794332..4794769 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JLZ94_RS23260 | 4794766..4795638 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
JLZ94_RS23265 | 4795632..4796231 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
JLZ94_RS23270 | 4796330..4797115 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T290037 WP_000897305.1 NZ_LR882978:c4792145-4791834 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|