Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 33502..33756 | Replicon | plasmid 2 |
| Accession | NZ_LR882974 | ||
| Organism | Escherichia coli isolate L2_E1649 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | JLZ81_RS23130 | Protein ID | WP_032186826.1 |
| Coordinates | 33502..33708 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 33700..33756 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ81_RS23100 | 28752..29933 | - | 1182 | WP_001467544.1 | DUF3800 domain-containing protein | - |
| JLZ81_RS23105 | 30191..30778 | + | 588 | Protein_33 | IS91 family transposase | - |
| JLZ81_RS23110 | 30929..31108 | - | 180 | WP_032231585.1 | hypothetical protein | - |
| JLZ81_RS23115 | 31811..32668 | - | 858 | WP_000130964.1 | incFII family plasmid replication initiator RepA | - |
| JLZ81_RS23120 | 32661..32735 | - | 75 | WP_001365571.1 | RepA leader peptide Tap | - |
| JLZ81_RS23125 | 32958..33218 | - | 261 | WP_000083817.1 | replication regulatory protein RepA | - |
| JLZ81_RS23130 | 33502..33708 | - | 207 | WP_032186826.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 33700..33756 | + | 57 | NuclAT_2 | - | Antitoxin |
| - | 33700..33756 | + | 57 | NuclAT_2 | - | Antitoxin |
| - | 33700..33756 | + | 57 | NuclAT_2 | - | Antitoxin |
| - | 33700..33756 | + | 57 | NuclAT_2 | - | Antitoxin |
| JLZ81_RS23135 | 34000..34182 | + | 183 | WP_001705320.1 | hypothetical protein | - |
| JLZ81_RS23140 | 34407..34820 | - | 414 | WP_077625677.1 | type-F conjugative transfer system pilin acetylase TraX | - |
| JLZ81_RS23145 | 35483..36934 | - | 1452 | Protein_41 | type IV conjugative transfer system coupling protein TraD | - |
| JLZ81_RS23150 | 36934..37185 | - | 252 | Protein_42 | conjugal transfer protein TraK | - |
| JLZ81_RS23155 | 37175..37738 | - | 564 | WP_000406020.1 | type IV conjugative transfer system protein TraE | - |
| JLZ81_RS23160 | 37758..38063 | - | 306 | WP_000016323.1 | type IV conjugative transfer system protein TraL | - |
| JLZ81_RS23165 | 38065..38424 | - | 360 | WP_001054220.1 | type IV conjugative transfer system pilin TraA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | cofA | 1..86517 | 86517 | |
| - | inside | IScluster/Tn | - | - | 17051..30778 | 13727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7822.32 Da Isoelectric Point: 8.8807
>T290016 WP_032186826.1 NZ_LR882974:c33708-33502 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAERSKFMTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
Antitoxin
Download Length: 57 bp
>AT290016 NZ_LR882974:33700-33756 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|