Detailed information of TA system TA290016

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 33502..33756
• Replicon: plasmid 2
• Accession: NZ_LR882974
• Organism: Escherichia coli isolate L2_E1649

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: JLZ81_RS23130
• Protein ID: WP_032186826.1
• Coordinates: 33502..33708 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	33700..33756 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JLZ81_RS23100	28752..29933	-	1182	WP_001467544.1	DUF3800 domain-containing protein	-
JLZ81_RS23105	30191..30778	+	588	Protein_33	IS91 family transposase	-
JLZ81_RS23110	30929..31108	-	180	WP_032231585.1	hypothetical protein	-
JLZ81_RS23115	31811..32668	-	858	WP_000130964.1	incFII family plasmid replication initiator RepA	-
JLZ81_RS23120	32661..32735	-	75	WP_001365571.1	RepA leader peptide Tap	-
JLZ81_RS23125	32958..33218	-	261	WP_000083817.1	replication regulatory protein RepA	-
JLZ81_RS23130	33502..33708	-	207	WP_032186826.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	33700..33756	+	57	NuclAT_2	-	Antitoxin
-	33700..33756	+	57	NuclAT_2	-	Antitoxin
-	33700..33756	+	57	NuclAT_2	-	Antitoxin
-	33700..33756	+	57	NuclAT_2	-	Antitoxin
JLZ81_RS23135	34000..34182	+	183	WP_001705320.1	hypothetical protein	-
JLZ81_RS23140	34407..34820	-	414	WP_077625677.1	type-F conjugative transfer system pilin acetylase TraX	-
JLZ81_RS23145	35483..36934	-	1452	Protein_41	type IV conjugative transfer system coupling protein TraD	-
JLZ81_RS23150	36934..37185	-	252	Protein_42	conjugal transfer protein TraK	-
JLZ81_RS23155	37175..37738	-	564	WP_000406020.1	type IV conjugative transfer system protein TraE	-
JLZ81_RS23160	37758..38063	-	306	WP_000016323.1	type IV conjugative transfer system protein TraL	-
JLZ81_RS23165	38065..38424	-	360	WP_001054220.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	cofA	1..86517	86517
	-	inside	IScluster/Tn	-	-	17051..30778	13727

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7822.32 Da
• Isoelectric Point: 8.8807

>T290016 WP_032186826.1 NZ_LR882974:c33708-33502 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

Antitoxin

Nucleotide

• Length: 57 bp

>AT290016 NZ_LR882974:33700-33756 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin