Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 23258..23675 | Replicon | plasmid 2 |
| Accession | NZ_LR882974 | ||
| Organism | Escherichia coli isolate L2_E1649 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JLZ81_RS23060 | Protein ID | WP_001312861.1 |
| Coordinates | 23258..23416 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 23481..23675 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ81_RS23030 | 18482..18892 | - | 411 | Protein_18 | Tn3 family transposase | - |
| JLZ81_RS23035 | 19101..19247 | + | 147 | Protein_19 | IS30 family transposase | - |
| JLZ81_RS23040 | 19583..19966 | - | 384 | WP_200986833.1 | hypothetical protein | - |
| JLZ81_RS23045 | 20565..21164 | - | 600 | WP_032302271.1 | proQ/FINO family protein | - |
| JLZ81_RS23050 | 21378..21563 | + | 186 | Protein_22 | transposase domain-containing protein | - |
| JLZ81_RS23060 | 23258..23416 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 23481..23675 | - | 195 | NuclAT_0 | - | Antitoxin |
| - | 23481..23675 | - | 195 | NuclAT_0 | - | Antitoxin |
| - | 23481..23675 | - | 195 | NuclAT_0 | - | Antitoxin |
| - | 23481..23675 | - | 195 | NuclAT_0 | - | Antitoxin |
| JLZ81_RS23065 | 23687..24406 | - | 720 | WP_001276221.1 | plasmid SOS inhibition protein A | - |
| JLZ81_RS23070 | 24403..24837 | - | 435 | WP_000845924.1 | conjugation system SOS inhibitor PsiB | - |
| JLZ81_RS23075 | 24892..26190 | - | 1299 | Protein_27 | hypothetical protein | - |
| JLZ81_RS23080 | 26189..27025 | + | 837 | Protein_28 | IS91 family transposase | - |
| JLZ81_RS23085 | 27302..27667 | + | 366 | WP_000124102.1 | hypothetical protein | - |
| JLZ81_RS23090 | 27652..27795 | + | 144 | Protein_30 | IS91 family transposase | - |
| JLZ81_RS23095 | 27982..28595 | - | 614 | Protein_31 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | cofA | 1..86517 | 86517 | |
| - | inside | IScluster/Tn | - | - | 17051..30778 | 13727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290012 WP_001312861.1 NZ_LR882974:c23416-23258 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 195 bp
>AT290012 NZ_LR882974:c23675-23481 [Escherichia coli]
TCACGCGGATTTCCCGTAGCCTGAATGAGCGTATTCTTTTCAGGAAAAGTGAATGTGGCCAGCGCGCAGGGATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACAGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACGCGGATTTCCCGTAGCCTGAATGAGCGTATTCTTTTCAGGAAAAGTGAATGTGGCCAGCGCGCAGGGATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACAGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|