Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3637323..3638017 Replicon chromosome
Accession NZ_LR882973
Organism Escherichia coli isolate L2_E1649

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag JLZ81_RS17795 Protein ID WP_001263493.1
Coordinates 3637323..3637721 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag JLZ81_RS17800 Protein ID WP_000554757.1
Coordinates 3637724..3638017 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLZ81_RS17765 3632323..3633567 - 1245 WP_000189541.1 esterase FrsA -
- 3632983..3633063 - 81 NuclAT_12 - -
- 3632983..3633063 - 81 NuclAT_12 - -
- 3632983..3633063 - 81 NuclAT_12 - -
- 3632983..3633063 - 81 NuclAT_12 - -
JLZ81_RS17770 3633659..3634117 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JLZ81_RS17775 3634378..3635835 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
JLZ81_RS17780 3635892..3636413 - 522 Protein_3479 peptide chain release factor H -
JLZ81_RS17785 3636412..3636615 - 204 Protein_3480 RNA ligase RtcB family protein -
JLZ81_RS17790 3636861..3637313 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
JLZ81_RS17795 3637323..3637721 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JLZ81_RS17800 3637724..3638017 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JLZ81_RS17805 3638069..3639124 - 1056 WP_001226164.1 DNA polymerase IV -
JLZ81_RS17810 3639195..3640118 - 924 WP_001232570.1 putative lateral flagellar export/assembly protein LafU -
JLZ81_RS17815 3640121..3640984 - 864 WP_001169518.1 flagellar motor stator protein MotA -
JLZ81_RS17820 3640997..3641716 - 720 WP_000938740.1 FliA/WhiG family RNA polymerase sigma factor -
JLZ81_RS17825 3641736..3642203 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T290010 WP_001263493.1 NZ_LR882973:c3637721-3637323 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT290010 WP_000554757.1 NZ_LR882973:c3638017-3637724 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References