Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 752286..752979 | Replicon | chromosome |
Accession | NZ_LR882973 | ||
Organism | Escherichia coli isolate L2_E1649 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | JLZ81_RS03710 | Protein ID | WP_000415584.1 |
Coordinates | 752286..752582 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | JLZ81_RS03715 | Protein ID | WP_000650107.1 |
Coordinates | 752584..752979 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ81_RS03675 | 747375..747689 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
JLZ81_RS03680 | 747720..748301 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
JLZ81_RS03685 | 748620..748952 | + | 333 | WP_000917686.1 | DUF2645 family protein | - |
JLZ81_RS03690 | 748998..750347 | - | 1350 | WP_000673409.1 | two-component system sensor histidine kinase QseC | - |
JLZ81_RS03695 | 750344..751003 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
JLZ81_RS03700 | 751155..751547 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
JLZ81_RS03705 | 751600..752082 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
JLZ81_RS03710 | 752286..752582 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
JLZ81_RS03715 | 752584..752979 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
JLZ81_RS03720 | 753112..754719 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
JLZ81_RS03725 | 754857..757115 | + | 2259 | WP_001281866.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T290000 WP_000415584.1 NZ_LR882973:752286-752582 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT290000 WP_000650107.1 NZ_LR882973:752584-752979 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|