Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 647894..648693 | Replicon | chromosome |
Accession | NZ_LR882973 | ||
Organism | Escherichia coli isolate L2_E1649 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | JLZ81_RS03190 | Protein ID | WP_000347273.1 |
Coordinates | 647894..648358 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | JLZ81_RS03195 | Protein ID | WP_001307405.1 |
Coordinates | 648358..648693 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ81_RS03160 | 642895..643329 | - | 435 | WP_000948842.1 | PTS sugar transporter subunit IIA | - |
JLZ81_RS03165 | 643347..644225 | - | 879 | WP_001705464.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JLZ81_RS03170 | 644215..644994 | - | 780 | WP_000406208.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JLZ81_RS03175 | 645005..645478 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JLZ81_RS03180 | 645501..646781 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JLZ81_RS03185 | 647030..647839 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JLZ81_RS03190 | 647894..648358 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JLZ81_RS03195 | 648358..648693 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JLZ81_RS03200 | 648842..650413 | - | 1572 | WP_001273790.1 | galactarate dehydratase | - |
JLZ81_RS03205 | 650788..652086 | + | 1299 | WP_001705462.1 | galactarate/glucarate/glycerate transporter GarP | - |
JLZ81_RS03210 | 652102..652872 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T289998 WP_000347273.1 NZ_LR882973:c648358-647894 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |