Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 776289..776902 | Replicon | chromosome |
Accession | NZ_LR882967 | ||
Organism | Planktothrix pseudagardhii strain No.713 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A1J1LMT6 |
Locus tag | NMK36_RS03260 | Protein ID | WP_072720388.1 |
Coordinates | 776289..776573 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1J1LP61 |
Locus tag | NMK36_RS03265 | Protein ID | WP_072720387.1 |
Coordinates | 776588..776902 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK36_RS03245 (NO713_00645) | 771527..771712 | - | 186 | WP_072720390.1 | hypothetical protein | - |
NMK36_RS03250 (NO713_00646) | 771887..772462 | - | 576 | WP_072720389.1 | hypothetical protein | - |
NMK36_RS03255 (NO713_00647) | 772725..775844 | - | 3120 | WP_083580092.1 | adenylate/guanylate cyclase domain-containing protein | - |
NMK36_RS03260 (NO713_00648) | 776289..776573 | + | 285 | WP_072720388.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMK36_RS03265 (NO713_00649) | 776588..776902 | + | 315 | WP_072720387.1 | HigA family addiction module antitoxin | Antitoxin |
NMK36_RS03270 (NO713_00650) | 776937..777059 | - | 123 | Protein_643 | Uma2 family endonuclease | - |
NMK36_RS03275 (NO713_00651) | 777214..778944 | - | 1731 | WP_254172976.1 | DNA repair protein RecN | - |
NMK36_RS03280 (NO713_00652) | 778996..781821 | - | 2826 | WP_254172977.1 | GAF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11193.72 Da Isoelectric Point: 9.7480
>T289988 WP_072720388.1 NZ_LR882967:776289-776573 [Planktothrix pseudagardhii]
MPQKYKDKRTAKFAAGDRVKKFQAFERQAYKRLEILEAAPNKESLIALPSNHFEALSGDRKGQYSIRINDKWRICFEWTE
TENRPFNIEIVDYH
MPQKYKDKRTAKFAAGDRVKKFQAFERQAYKRLEILEAAPNKESLIALPSNHFEALSGDRKGQYSIRINDKWRICFEWTE
TENRPFNIEIVDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1LMT6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1LP61 |